Purified Membrane Proteins

Transmembrane protein 265

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM265_HUMAN

Gene Name:

TMEM265

Uniprot Accession:

A0A087WTH1

Origin:

Homo sapiens (Human)

Protein family:

CD225/Dispanin family

Full-length:

108

AA

Mass:

11832

Da

MEDEEKAVEILGNTEAAHPPSPIRCCWLRLRCLAATSIICGCSCLGVMALVFAIKAEERHKAGRSEEAVRWGARARKLILASFAVWLAVLILGPLLLWLLSYAIAQAE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes