Purified Membrane Proteins

Small integral membrane protein 26

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SIM26_HUMAN

Gene Name:

SMIM26

Uniprot Accession:

A0A096LP01

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

95

AA

Mass:

10908

Da

MYRNEFTAWYRRMSVVYGIGTWSVLGSLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes