Purified Membrane Proteins

Transmembrane protein CCDC163 (Coiled-coil domain-containing protein 163) (coiled-coil domain containing 163 pseudogene)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CC163_HUMAN

Gene Name:

CCDC163 C1orf231 CCDC163P

Uniprot Accession:

A0A0D9SF12

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

145

AA

Mass:

16203

Da

MNTSLSWFEQLDVLLNATDGNVVRNKQWLYPLGVSTELIGLCICFFCSSGCIFLGSPPQNSTAVTPAVLWEESEIMQKELKLLQYQLSQHQELLLKQLAEGRQAQVGSWKIPRGAPFLTWSPASFSSMPRVLSKRTYSFGAPKCS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes