Purified Membrane Proteins

Putative transmembrane protein SPTY2D1OS (SPTY2D1 antisense RNA 1) (SPTY2D1 opposite strand)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SPTOS_HUMAN

Gene Name:

SPTY2D1OS SPTY2D1-AS1

Uniprot Accession:

A0A0U1RRN3

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

59

AA

Mass:

6977

Da

MIVLGWMFFVGLVCYMGTFPELMPPTLKWQERWPVQESKTQLRRRALGEDLLQNHVEGI

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes