Purified Membrane Proteins

Transmembrane protein 272

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM272_HUMAN

Gene Name:

TMEM272

Uniprot Accession:

A0A1B0GTI8

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

187

AA

Mass:

21340

Da

MPGGLEKTCHQCISKIASNACFVVVLCAFLALPLSMTFIGMKFLEDCPIQPLIPLYLLVGGIVGTLKVSLLLYDSTRMRRLLSKAVVIDDDDDDEYPWRQNAHRYYIHLLLSLFLFLWFILGNYWVFSVYLPDFLPPFQQPQDYCDKTLYLFAVGVLALSHTVLVLLLLCSGCVYLCSRWRLAADED

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes