Purified Membrane Proteins

Testis-expressed protein 50

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TEX50_HUMAN

Gene Name:

TEX50

Uniprot Accession:

A0A1B0GTY4

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

177

AA

Mass:

20847

Da

MSNQRLPLIFSLLFICFFGESFCICDGTVWTKVGWEILPEEVHYWKVKGSPSHCLPYLLDKLCCDFANMDIFQGCLYLIYNLLQAVFFVLFVLSVHYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes