Purified Membrane Proteins

Small integral membrane protein 27 (TOPORS antisense RNA 1)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SIM27_HUMAN

Gene Name:

SMIM27 C9orf133 TOPORS-AS1

Uniprot Accession:

A0A1B0GUW7

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

55

AA

Mass:

6429

Da

MKPVSRRTLDWIYSVLLLAIVLISWGCIIYASMVSARRQLRKKYPDKIFGTNENL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes