Purified Membrane Proteins

Small integral membrane protein 35 (TMPRSS4 antisense RNA 1)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SIM35_HUMAN

Gene Name:

SMIM35 TMPRSS4-AS1

Uniprot Accession:

A0A1B0GVV1

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

85

AA

Mass:

9379

Da

MTGEDSISTLGLILGVGLLLLLVSILGYSLAKWYQRGYCWEGPNFVFNLYQIRNLKDLEMGPPFTISGHISSTDGGYMKFSNGLV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes