Purified Membrane Proteins

Proline rich transmembrane protein 1B

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

PRT1B_HUMAN

Gene Name:

PRRT1B IFITMD8

Uniprot Accession:

A0A1B0GWB2

Origin:

Homo sapiens (Human)

Protein family:

CD225/Dispanin family

Full-length:

263

AA

Mass:

26769

Da

MEAGAGGAGSDTKGGGSPATPEDPRSPAKPAAPEDPQMPAQPALPQLPRRPRTLDEDGAPSEDGAAGGSEPAPEDAPAQAAGEAGPVSKAAAGGAPHIGFVGEPPPYAPPDPKAAPLLYPPFPQVPVVLQPAPSALFPPPAQLYPAAPTPPALFSPPAGAAFPFPVYNGPMAGVPGPATVEHRPLPKDYMMESVLVTLFCCLLTGLIAIVYSHEARAALGRGDLAQAEEASRKARSLVLFSLLFGVFVSTSWVIYVVVALYLP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes