Purified Membrane Proteins

Serine-rich and transmembrane domain-containing 2

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SRTM2_HUMAN

Gene Name:

SERTM2

Uniprot Accession:

A0A1B0GWG4

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

90

AA

Mass:

10219

Da

MMEAHFKYHGNLTGRAHFPTLATEVDTSSDKYSNLYMYVGLFLSLLAILLILLFTMLLRLKHVISPINSDSTESVPQFTDVEMQSRIPTP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes