Purified Membrane Proteins

Transmembrane protein PMIS2

May play a role in spermatozoa mobility. {ECO:0000250|UniProtKB:Q8CES1}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

PMIS2_HUMAN

Gene Name:

PMIS2

Uniprot Accession:

A0A1W2PS18

Origin:

Homo sapiens (Human)

Protein family:

CD225/Dispanin family

Full-length:

150

AA

Mass:

15819

Da

MALKPPSATQPAPNAPATPDAPPTTGDPGASAAPGSPTTTGGPGAPAEVPQEPQEPTQTPEELAFYAPNYLCLTIFAILLFPPFGLAALYFSYEGSWTQKPTSMLPPLQTMKANQNSEWEEAYINSGRTGWFGAFVVMIGLGIIYGLVLY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes