Purified Membrane Proteins

Taurine up-regulated 1 protein

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TUG1_HUMAN

Gene Name:

TUG1

Uniprot Accession:

A0A6I8PU40

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

153

AA

Mass:

16006

Da

MARPPPLPGLVGRRNGRAVDRAIGWRLFLLLWHPALGAQARPPRRAPGGRWRSRRVFLLVRRTRAAAYAFAIRRGVVRVVGGGGQLLRPAPGEAAAAAAAGFGAAGEAGVAGAGLEAWRHPSGPARTQLGGQEGAGGWLVVGFLLCLFLLMPP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes