Purified Membrane Proteins

Immunoglobulin superfamily member 23

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

IGS23_HUMAN

Gene Name:

IGSF23

Uniprot Accession:

A1L1A6

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

192

AA

Mass:

20591

Da

MRAKPQSPLPRNPVPAWSPPTTTTDPMLEKDAAGGDFPANLVLQLMPLKTFPAAIRGVIQSELNYSVILQWVVTMDPEPVLSWTFSGVPCGMGEKLFIRRLSCEQLGTYMCIATNSKKQLVSEPVTISLPKPIMQPTEAEPMEPDPTLSLSGGSAIGLLAAGILGAGALIAGMCFIIIQSLRTDRQRIGICS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes