Purified Membrane Proteins

Testis-specific XK-related protein, Y-linked 2

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

XKRY2_HUMAN

Gene Name:

XKRY2

Uniprot Accession:

A2RUG3

Origin:

Homo sapiens (Human)

Protein family:

XK family

Full-length:

117

AA

Mass:

12988

Da

MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVVTLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKNNSSMVGKYGCLS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes