Purified Membrane Proteins

Transmembrane protein 89

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TMM89_HUMAN

Gene Name:

TMEM89

Uniprot Accession:

A2RUT3

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

159

AA

Mass:

17572

Da

MLHVLASLPLLLLLVTSASTHAWSRPLWYQVGLDLQPWGCQPKSVEGCRGGLSCPGYWLGPGASRIYPVAAVMITTTMLMICRKILQGRRRSQATKGEHPQVTTEPCGPWKRRAPISDHTLLRGVLHMLDALLVHIEGHLRHLATQRQIQIKGTSTQSG

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes