Purified Membrane Proteins

Putative transmembrane protein encoded by LINC00862 (Small integral membrane protein 16)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SIM16_HUMAN

Gene Name:

LINC00862 C1orf98 SMIM16

Uniprot Accession:

A6NCI5

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

91

AA

Mass:

10419

Da

MVCYLYWETFPSISHLLKITLSARDCHVCGLNLFIFMDPVENQALHPVIMALILMPSLHCFGNILILLFLKSPAQLFCRMSVDLALLFPHK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes