Purified Membrane Proteins

Putative transmembrane protein ENSP00000320207

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

YO011_HUMAN

Gene Name:

Uniprot Accession:

A6NDX4

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

124

AA

Mass:

13671

Da

MYVSISFLLGLSHLVLCCLLTFIVNFYLPPESIDFEFMAHNWSKGRSPSSTLGLSWFKAGFRFSDGWSMFYSSGLPGVALPGSPPRSHLLPGTQILIRSFQPCESAKHSARLSSLLTTTSYSVS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes