Purified Membrane Proteins

Protein FAM205C (FAM205C pseudogene)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

F205C_HUMAN

Gene Name:

FAM205C FAM205CP

Uniprot Accession:

A6NFA0

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

338

AA

Mass:

37613

Da

MLSPTFVLWDVGYPLYTYGSICIIALIIWQVKKSCQKLSLVPNRSCCRCHRRVQQKSGDRTSRARRTSQEEAEKLWKLLFLMKSQGWLPQEGSVRRILCADPCCQICNVMALEIKQLLAGENNQISLTSLGPSQGSSCLEALSTSSVSFKHSQDLGSPKSKELSLASVTPTLSQLMDQKSLTQSAARSAGADSVQDSWADHFQRGQRSQVPAVSQVMGSLSSNFEKPGIPLSQQERTKNNSKFVLENQEAPEVGLDNKMKLFLHWINPEMKDRRHEESILLSKAETVTQDRTKNIEKSPTVTKDHVWGATTQKTTEDPEAQPPSTEEEGLIFCDAPSA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes