Purified Membrane Proteins

Putative SLC9B1-like protein SLC9B1P1 (Solute carrier family 9 subfamily B member 1 pseudogene 1)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SL9P1_HUMAN

Gene Name:

SLC9B1P1

Uniprot Accession:

A6NJY1

Origin:

Homo sapiens (Human)

Protein family:

Monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family

Full-length:

282

AA

Mass:

30828

Da

MVLQENGYGVEEDIPTLLMAASSMDDLLAITGFNTCLSIVFYSGGMINNAIASLRNVCISLLAGIVLGFFVRYFPSEDQKKITLKRGFLVLITFVSAVLGSQPIGLHGSGGLCTLVLHFIEWTKWSQEKMKVQKIITNVWDIFQPLLFGLVGAEVSVSLLESNIVGISVSTLSLALCVRILNIYLLMCFAGFSFKEKIFIALAWMPKATVQAVLGPLALETARVSTPHLETYAKDVMTVAFLAIMITAPNGALLMGILGPKMLTRHYDPSKIKLQLSTLEHH

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes