Purified Membrane Proteins

Transmembrane protein 88B

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM88B_HUMAN

Gene Name:

TMEM88B

Uniprot Accession:

A6NKF7

Origin:

Homo sapiens (Human)

Protein family:

TMEM88 family

Full-length:

163

AA

Mass:

17097

Da

MSEQGRETEEEEGGGGASDTAPMLPRGPPDHQASALTCPGWSGPPLLPGRLLAGLLLHLLLPAAAFLLVLLPAAAVVYLGFLCHSRVHPAPGPRCRALFSDRGSAALIVFGLLSLPPLLVLASAVRARLARRLRPLLPPPAGTPGPRRPPGRPDEDEQLCAWV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes