Purified Membrane Proteins

Protein shisa-like-2B

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SHL2B_HUMAN

Gene Name:

SHISAL2B FAM159B

Uniprot Accession:

A6NKW6

Origin:

Homo sapiens (Human)

Protein family:

Shisa family

Full-length:

160

AA

Mass:

17663

Da

MSEASRLCSGYYSLNQSFVEPFQCPRRGEGAALQYCCGFADLKYCCSEPGSYFPYKHSYMWSLSIGALIGLGIAALVLLAFVISVCVLCYLFLYTKPQRLDTGLKLQHLEASSTQEGKSNGKTKALNSNAASNATNETYYEADDIIQEKTMDATQIHIAY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes