Purified Membrane Proteins

Putative POM121-like protein 1-like

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

P12LL_HUMAN

Gene Name:

Uniprot Accession:

A6NNC1

Origin:

Homo sapiens (Human)

Protein family:

POM121 family

Full-length:

897

AA

Mass:

94058

Da

MPEQDKDPRVQENPDDQRTVPEVTGDARSAFWPLRDNGGPSPFVPRPGPLQTDLHAQSSEIRYNHTSQTSWTSSSTKRNAISSSYSSTGGLPGLKQRRGPASSRCQLTLSYSKTVSEDRPQAVSSGHTRCEKGADTAPGQTIAPTGGSPRSQDSRPRRRKIPLLPRRRGEPLMLPPPLELGYRVTAEDLHLEKETAFQRINSALHVEDKAIPDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDSLGLLAPLASAAEVPSTAPVSGKKHRPPGPLFSSSDPLPATSYHSRDTAQVTSLIPATFTAASRDAGMRRTRSAPAAATAAPPPSTLNNTSGSLLNAVDGGPSHFLASATAAARAQRSEVRYNQRSQTSRTRSCLKRNASSSSSSHSSTEGLQELKRRRGPASSHCQLAHSSSNTVSEDGPQAVSSGHRCENKAGTAPGQTLAPRGGSPRSQASRPHINSALYVEDKAISDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDCLGLVAPLASAAEVPSTAPVSGKKHRPPGPLFSSSDPLPATSSHSRDSAQVTSLIPATFTAASRDAGMRRTRPGTSAPAAAAAALPPSTLNPTSGSLLNAVDGGPSHFLASATAAARAQRSEVRYNQRSQTSRTRSCLKRNASSSSHSSTEGLQELKRRRGPASSHCQLAHSSSNTVSEDGPQAVSSGHRCENKAGTAPGQTLAPRGGYPRSQASRPRINSALHVEDKAISDCRPSRPSHTLSSLATGASGGPPVSKAPTMDAQQDRPKSQDCLGLLAPLASAAEVSSTAPVSGKKHRPPGPLFSSSDPLPATSSHSGDSAQDTSLIPAPFTPASRDAGIRRMFRVRNCLRGLGLFLLVFSFFFLLTWASFSF

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes