Purified Membrane Proteins

Protein CEBPZOS (CEBPZ antisense RNA 1) (CEBPZ opposite strand)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CEBOS_HUMAN

Gene Name:

CEBPZOS CEBPZ-AS1

Uniprot Accession:

A8MTT3

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

80

AA

Mass:

9336

Da

MARTLEPLAKKIFKGVLVAELVGVFGAYFLFSKMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQKTWLNSKN

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes