Purified Membrane Proteins

Putative synaptogyrin-2 like protein

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SNG2L_HUMAN

Gene Name:

Uniprot Accession:

A8MWL6

Origin:

Homo sapiens (Human)

Protein family:

Synaptogyrin family

Full-length:

223

AA

Mass:

24647

Da

MESGAYGVAEAGGSFDLRPFLTQPQVVARALCLVFALIVFSCIYGEGYSNTHKSKQMYCVFNHNEDACRYGSAIGVLAFLASAFLVVDAYFPQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAVTDPEDVLVGADSARAAITFSFFSIFSWGVLASLTYQRYKAGVDDFIQNYVDPSPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes