Purified Membrane Proteins

Transmembrane and coiled-coil domain-containing protein 5B

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TMC5B_HUMAN

Gene Name:

TMCO5B

Uniprot Accession:

A8MYB1

Origin:

Homo sapiens (Human)

Protein family:

TMCO5 family

Full-length:

307

AA

Mass:

35763

Da

MEDVGQNPLDDVKNIFFASSLEAVKQNLDCLNSDLEKDLQKLDMENQVLLRKIKEKEETISSLERKLALSLEEAKEEEELNYVIDEQEESLRELELETAKLEKSNAILSRNVVEVQKKISGLFTNIGLEEETTKQILEEMKARLQKSTESCAKQEEELAKIESDYQSVSDLCKDQVYYIKKYQEVLRKMKEEKETLLLEKQISKAQDDSSQTVKPGSILADTTQRNMERTTIKKQERRCWYKYFQYLTFMVLVFIRLLAYVIFHLQYINPDLLVDVLPLVLSRGTLESLRKVSHPFLTLAVEEALPH

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes