Purified Membrane Proteins

Uroplakin-3b-like protein 1

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

UPK3L_HUMAN

Gene Name:

UPK3BL1 UPLP

Uniprot Accession:

B0FP48

Origin:

Homo sapiens (Human)

Protein family:

Uroplakin-3 family

Full-length:

263

AA

Mass:

28385

Da

MDNSWRLGPAIGLSAGQSQLLVSLLLLLTRVQPGTDVAAPEHISYVPQLSNDTLAGRLTLSTFTLEQPLGQFSSHNISDLDTIWLVVALSNATQSFTAPRTNQDIPAPANFSQRGYYLTLRANRVLYQTRGQLHVLRVGNDTHCQPTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVPGPQSPGTVVIIAILSILLAVLLTVLLAVLIYTCFNSCRSTSLSGPEEAGSVRRYTTHLAFSTPAEGAS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes