Purified Membrane Proteins

PRA1 family protein 2

May be involved in ER/Golgi transport and vesicular traffic. Plays a proapoptotic role in cerulenin-induced neuroblastoma apoptosis.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

PRAF2_HUMAN

Gene Name:

PRAF2

Uniprot Accession:

O60831

Origin:

Homo sapiens (Human)

Protein family:

PRA1

Full-length:

178

AA

Mass:

19258

Da

MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes