Purified Membrane Proteins

Leptin receptor overlapping transcript-like 1 (Endospanin-2)

Negatively regulates growth hormone (GH) receptor cell surface expression in liver. May play a role in liver resistance to GH during periods of reduced nutrient availability. {ECO:0000269|PubMed:19907080}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

LERL1_HUMAN

Gene Name:

LEPROTL1 My047 UNQ577/PRO1139

Uniprot Accession:

O95214

Origin:

Homo sapiens (Human)

Protein family:

OB-RGRP/VPS55 family

Full-length:

131

AA

Mass:

14428

Da

MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQW

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes