Purified Membrane Proteins

Protein cornichon homolog 1 (CNIH-1) (Cornichon family AMPA receptor auxiliary protein 1) (Protein cornichon homolog) (T-cell growth-associated molecule 77) (TGAM77)

Involved in the selective transport and maturation of TGF-alpha family proteins. {ECO:0000269|PubMed:17607000}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CNIH1_HUMAN

Gene Name:

CNIH1 CNIH CNIL UNQ155/PRO181

Uniprot Accession:

O95406

Origin:

Homo sapiens (Human)

Protein family:

Cornichon family

Full-length:

144

AA

Mass:

16699

Da

MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes