Purified Membrane Proteins

Brain protein I3 (pRGR2)

Participates in tumor necrosis factor-alpha (TNF)-induced cell death (PubMed:14592447). May be a target of Wnt/beta-catenin signaling in the liver (PubMed:20538055). {ECO:0000269|PubMed:14592447, ECO:0000269|PubMed:20538055}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

BRI3_HUMAN

Gene Name:

BRI3

Uniprot Accession:

O95415

Origin:

Homo sapiens (Human)

Protein family:

BRI3 family

Full-length:

125

AA

Mass:

13645

Da

MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHHPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes