Purified Membrane Proteins

Claudin-7 (CLDN-7)

Plays a major role in tight junction-specific obliteration of the intercellular space. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CLD7_HUMAN

Gene Name:

CLDN7 CEPTRL2 CPETRL2

Uniprot Accession:

O95471

Origin:

Homo sapiens (Human)

Protein family:

Claudin family

Full-length:

211

AA

Mass:

22418

Da

MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes