Purified Membrane Proteins

Cytochrome b5 (Microsomal cytochrome b5 type A) (MCB5)

Cytochrome b5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CYB5_HUMAN

Gene Name:

CYB5A CYB5

Uniprot Accession:

P00167

Origin:

Homo sapiens (Human)

Protein family:

Cytochrome b5 family

Full-length:

134

AA

Mass:

15330

Da

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes