Purified Membrane Proteins

Cortexin-2

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CTXN2_HUMAN

Gene Name:

CTXN2

Uniprot Accession:

P0C2S0

Origin:

Homo sapiens (Human)

Protein family:

Cortexin family

Full-length:

81

AA

Mass:

8980

Da

MSSTYCGNSSAKMSVNEVSAFSLTLEQKTGFAFVGILCIFLGLLIIRCFKILLDPYSSMPSSTWEDEVEEFDKGTFEYALA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes