Purified Membrane Proteins

Transmembrane protein 253

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM253_HUMAN

Gene Name:

TMEM253 C14orf176 C14orf95

Uniprot Accession:

P0C7T8

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

217

AA

Mass:

23522

Da

MEDRAGEQEQERHSLRLEKLQHWARHRQSGHLLVLAVSQLWLAVVVVPLAVSVACLNSDCHMATALPLGPGASGLLTGTVTLELRRAPRLWKVRAMMIFNTFNLILGFIVVVVEVMKTALGPAPTASSQHAGLLVLELSAEAFTLGGVLVSVHALFLLSQRKPGCCRSQSLHYQELQEGFSELEEVPGLENGPTVASTGANERVGQREQTRAALLPP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes