Purified Membrane Proteins

Protein Mpv17

Non-selective channel that modulates the membrane potential under normal conditions and oxidative stress, and is involved in mitochondrial homeostasis (PubMed:25861990). Involved in mitochondrial deoxynucleoside triphosphates (dNTP) pool homeostasis and mitochondrial DNA (mtDNA) maintenance (PubMed:26760297). May be involved in the regulation of reactive oxygen species metabolism and the control of oxidative phosphorylation (By similarity). {ECO:0000250|UniProtKB:P19258, ECO:0000269|PubMed:25861990, ECO:0000269|PubMed:26760297}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

MPV17_HUMAN

Gene Name:

MPV17

Uniprot Accession:

P39210

Origin:

Homo sapiens (Human)

Protein family:

Peroxisomal membrane protein PXMP2/4 family

Full-length:

176

AA

Mass:

19733

Da

MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes