Purified Membrane Proteins

Killer cell immunoglobulin-like receptor 2DS2 (CD158 antigen-like family member J) (NK receptor 183 ActI) (Natural killer-associated transcript 5) (NKAT-5) (p58 natural killer cell receptor clone CL-49) (p58 NK receptor CL-49) (CD antigen CD158j)

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

KI2S2_HUMAN

Gene Name:

KIR2DS2 CD158J NKAT5

Uniprot Accession:

P43631

Origin:

Homo sapiens (Human)

Protein family:

Immunoglobulin superfamily

Full-length:

304

AA

Mass:

33502

Da

MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFEHFLLHREGKYKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLHVLIGTSVVKIPFTILLFFLLHRWCSNKKNAAVMDQEPAGNRTVNSEDSDEQDHQEVSYA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes