Purified Membrane Proteins

Chemerin-like receptor 2 (Chemerin chemokine-like receptor 2) (Chemokine-like receptor 2) (G-protein coupled receptor 1)

Receptor for chemoattractant adipokine chemerin/RARRES2 suggesting a role for this receptor in the regulation of inflammation and energy homesotasis (PubMed:18165312, PubMed:27716822). Signals mainly via beta-arrestin pathway. Binding of RARRES2 activates weakly G proteins, calcium mobilization and MAPK1/MAPK3 (ERK1/2) phosphorylation too (PubMed:27716822). Acts also as a receptor for TAFA1, mediates its effects on neuronal stem-cell proliferation and differentiation via the activation of ROCK/ERK and ROCK/STAT3 signaling pathway (By similarity). {ECO:0000250|UniProtKB:Q8K087, ECO:0000269|PubMed:18165312, ECO:0000269|PubMed:27716822}.; (Microbial infection) Coreceptor for HIV-1. {ECO:0000269|PubMed:10233994}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CML2_HUMAN

Gene Name:

CMKLR2 GPR1

Uniprot Accession:

P46091

Origin:

Homo sapiens (Human)

Protein family:

Chemokine-like receptor (CMKLR) family

Full-length:

355

AA

Mass:

41431

Da

MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes