Purified Membrane Proteins

Transmembrane 4 L6 family member 4 (Intestine and liver tetraspan membrane protein) (IL-TMP)

Regulates the adhesive and proliferative status of intestinal epithelial cells. Can mediate density-dependent cell proliferation.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

T4S4_HUMAN

Gene Name:

TM4SF4 ILTMP

Uniprot Accession:

P48230

Origin:

Homo sapiens (Human)

Protein family:

L6 tetraspanin family

Full-length:

202

AA

Mass:

21396

Da

MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes