Purified Membrane Proteins

Type I iodothyronine deiodinase (EC 1.21.99.4) (5DI) (DIOI) (Type 1 DI) (Type-I 5'-deiodinase)

Responsible for the deiodination of T4 (3,5,3′,5′-tetraiodothyronine) into T3 (3,5,3′-triiodothyronine) and of T3 into T2 (3,3′-diiodothyronine). Plays a role in providing a source of plasma T3 by deiodination of T4 in peripheral tissues such as liver and kidney.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

IOD1_HUMAN

Gene Name:

DIO1 ITDI1 TXDI1

Uniprot Accession:

P49895

Origin:

Homo sapiens (Human)

Protein family:

Iodothyronine deiodinase family

Full-length:

249

AA

Mass:

28924

Da

MGLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCTUPSFMFKFDQFKRLIEDFSSIADFLVIYIEEAHASDGWAFKNNMDIRNHQNLQDRLQAAHLLLARSPQCPVVVDTMQNQSSQLYAALPERLYIIQEGRILYKGKSGPWNYNPEEVRAVLEKLHS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes