Purified Membrane Proteins

Sodium/potassium-transporting ATPase subunit gamma (Na(+)/K(+) ATPase subunit gamma) (FXYD domain-containing ion transport regulator 2) (Sodium pump gamma chain)

May be involved in forming the receptor site for cardiac glycoside binding or may modulate the transport function of the sodium ATPase.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

ATNG_HUMAN

Gene Name:

FXYD2 ATP1C ATP1G1

Uniprot Accession:

P54710

Origin:

Homo sapiens (Human)

Protein family:

FXYD family

Full-length:

66

AA

Mass:

7283

Da

MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes