Purified Membrane Proteins

Adipogenin

Plays a role in stimulating adipocyte differentiation and development. {ECO:0000250|UniProtKB:Q8R400}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

ADIG_HUMAN

Gene Name:

ADIG

Uniprot Accession:

Q0VDE8

Origin:

Homo sapiens (Human)

Protein family:

Adipogenin family

Full-length:

80

AA

Mass:

9465

Da

MKYPLMPLVNDLTFSFLVFWFCLPVGLLLLLIIWLRFLLSQDSEENDSSVCLDWEPWSKGPAEFCWKGTLHGQEKERPCW

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes