Purified Membrane Proteins

Putative transmembrane protein 183BP (Transmembrane protein 183B pseudogene)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

T183B_HUMAN

Gene Name:

TMEM183BP C1orf37-dup TMEM183B

Uniprot Accession:

Q1AE95

Origin:

Homo sapiens (Human)

Protein family:

TMEM183 family

Full-length:

376

AA

Mass:

42940

Da

MARGPGPLGRPRPDTVAMPKRGKRLKFRAHDACSGRVTVADYADSDLAVVRSGRVKKAVANAVRQEVKSLCGLEASQVPAEEALSGAGEPYDIIDSSDEMDAQEENIHERTVSRKKKSKRHKEELDGAGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPLRLRPESMEKLHCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCTGGLQPPVQYEDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGVQVILDPVHSVRLFDWWHPQYPFSLRA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes