Purified Membrane Proteins

Transmembrane protein 241

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM241_HUMAN

Gene Name:

TMEM241 C18orf45

Uniprot Accession:

Q24JQ0

Origin:

Homo sapiens (Human)

Protein family:

TMEM241 family

Full-length:

296

AA

Mass:

32647

Da

MCVRRSLVGLTFCTCYLASYLTNKYVLSVLKFTYPTLFQGWQTLIGGLLLHVSWKLGWVEINSSSRSHVLVWLPASVLFVGIIYAGSRALSRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQFNPDGYFWAIIHLLCVGAYKILQKSQKPSALSDIDQQYLNYIFSVVLLAFASHPTGDLFSVLDFPFLYFYRFHGSCCASGFLGFFLMFSTVKLKNLLAPGQCAAWIFFAKIITAGLSILLFDAILTSATTGCLLLGALGEALLVFSERKSS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes