Purified Membrane Proteins

Inactive N-acetyllactosaminide alpha-1,3-galactosyltransferase (Glycoprotein alpha-galactosyltransferase 1 pseudogene)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

GGTA1_HUMAN

Gene Name:

GGTA1 GGTA1P

Uniprot Accession:

Q4G0N0

Origin:

Homo sapiens (Human)

Protein family:

Glycosyltransferase 6 family

Full-length:

100

AA

Mass:

11568

Da

MNVKGKVILSMLVVSTVIIVFWEFINSTEGSFLWIYHSKNPEVDDSSAQKGWWFLSWFNNGIHNYQQGEEDIDKEKGREETKGRKMTQQSFGYGTGLIQT

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes