Purified Membrane Proteins

Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 (Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 1) (Protein FAM77C)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

NKAI1_HUMAN

Gene Name:

NKAIN1 FAM77C

Uniprot Accession:

Q4KMZ8

Origin:

Homo sapiens (Human)

Protein family:

NKAIN family

Full-length:

207

AA

Mass:

23552

Da

MGKCSGRCTLVAFCCLQLVAALERQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSRYLILYAAWLVLWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTSG

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes