Purified Membrane Proteins

Putative HIG1 domain family member 2B (HIG1 domain family member 2B pseudogene)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

HIG2B_HUMAN

Gene Name:

HIGD2B HIGD2BP

Uniprot Accession:

Q4VC39

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

106

AA

Mass:

11405

Da

MATLGFVTPEAPFESSKPPIFEGLSPTVYSNPEGFKEKFLRKTRENPVVPIGFLCTAAVLTNGLYCFHQGNSQCSRLMMHTQIAAQGFTIAAILLGLAATAMKSPP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes