Purified Membrane Proteins

KH homology domain-containing protein 1

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

KHDC1_HUMAN

Gene Name:

KHDC1 C6orf147 C6orf148

Uniprot Accession:

Q4VXA5

Origin:

Homo sapiens (Human)

Protein family:

KHDC1 family

Full-length:

237

AA

Mass:

27160

Da

MLSAFQRLFRVLFVIETVSEYGVLIFIYGWPFLQTLAMLLIGTVSFHLWIRRNRERNSRSGKTRCRSKRSEQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGDTYLRCIEVHSHTLIQLESWFTATGQTRVTVVGPHRARQWLLHMFCCVGSQDSYHHARGLEMLERVRSQPLTNDDLVTSISVPPYTGDLSLAPRISGTVCLSVPQPSPYQVIGCSGFHLSSLYP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes