Purified Membrane Proteins

Keratinocyte-associated protein 3 (KCP-3)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

KCP3_HUMAN

Gene Name:

KRTCAP3 KCP3 UNQ3066/PRO9898

Uniprot Accession:

Q53RY4

Origin:

Homo sapiens (Human)

Protein family:

TMEM54 family

Full-length:

240

AA

Mass:

25627

Da

MRRCSLCAFDAARGPRRLMRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTVANVISVGSGLLSVSVGLVALLASRNLLRPPLHWVLLALALVNLLLSVACSLGLLLAVSLTVANGGRRLIADCHPGLLDPLVPLDEGPGHTDCPFDPTRIYDTALALWIPSLLMSAGEAALSGYCCVAALTLRGVGPCRKDGLQGQLEEMTELESPKCKRQENEQLLDQNQEIRASQRSWV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes