Purified Membrane Proteins

XK-related protein 9 (hXKR9) [Cleaved into: XK-related protein 9, processed form]

[XK-related protein 9, processed form]: Phospholipid scramblase that promotes phosphatidylserine exposure on apoptotic cell surface (PubMed:25231987). Phosphatidylserine is a specific marker only present at the surface of apoptotic cells and acts as a specific signal for engulfment (PubMed:25231987). {ECO:0000269|PubMed:25231987}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

XKR9_HUMAN

Gene Name:

XKR9 XRG9

Uniprot Accession:

Q5GH70

Origin:

Homo sapiens (Human)

Protein family:

XK family

Full-length:

373

AA

Mass:

43406

Da

MKYTKQNFMMSVLGIIIYVTDLIVDIWVSVRFFHEGQYVFSALALSFMLFGTLVAQCFSYSWFKADLKKAGQESQHCFLLLHCLQGGVFTRYWFALKRGYHAAFKYDSNTSNFVEEQIDLHKEVIDRVTDLSMLRLFETYLEGCPQLILQLYILLEHGQANFSQYAAIMVSCCAISWSTVDYQVALRKSLPDKKLLNGLCPKITYLFYKLFTLLSWMLSVVLLLFLNVKIALFLLLFLWLLGIIWAFKNNTQFCTCISMEFLYRIVVGFILIFTFFNIKGQNTKCPMSCYYIVRVLGTLGILTVFWVCPLTIFNPDYFIPISITIVLTLLLGILFLIVYYGSFHPNRSAETKCDEIDGKPVLRECRMRYFLME

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes