Purified Membrane Proteins

Kita-kyushu lung cancer antigen 1 (KK-LC-1) (Cancer/testis antigen 83)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

KKLC1_HUMAN

Gene Name:

CT83 CXorf61 KKLC1

Uniprot Accession:

Q5H943

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

113

AA

Mass:

12784

Da

MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes